Tesamorelin and Ipamorelin Blend 8mg (6mg/2mg)

£109.99

+ Free Shipping

This Tesamorelin/Ipamorelin blend combines Tesamorelin, a growth hormone-releasing hormone (GHRH) analogue, with Ipamorelin, a selective growth hormone secretagogue, to facilitate controlled studies of growth hormone pathways. The complementary mechanisms of these peptides may work together to potentially enhance body composition, support tissue repair, and improve metabolic parameters.

Tesamorelin Ipamorelin 8mg (6mg/2mg) Description

The Tesamorelin Ipamorelin 8mg combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.

This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).

Tesamorelin Ipamorelin 8mg (6mg/2mg) Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

  • Tesamorelin acetate
  • 901758-09-6
  • TH9507
  • UNII-LGW5H38VE3
  • Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C38H49N9O5

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

  • 170851-70-4
  • Ipamorelin [INN]
  • NNC-26-0161
  • UNII-Y9M3S784Z6

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin and Ipamorelin Blend 8mg (6mg/2mg)”

Your email address will not be published. Required fields are marked *

Shopping Cart
error: Content is protected !!